PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PEQU_31638
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Vandeae; Aeridinae; Phalaenopsis
Family HB-other
Protein Properties Length: 1746aa    MW: 196517 Da    PI: 5.602
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PEQU_31638genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox55.21.2e-172883257
                T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
    Homeobox  2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57
                +kR   +++qle+Le+ ++ + yps++ r+eL++k+gL++rq ++WF+ rR k++k
  PEQU_31638 28 SKRKMKSPYQLEILEKTYAVETYPSETLRAELSAKTGLSDRQLQMWFCHRRLKDRK 83
                589999************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.7E-151883IPR009057Homeodomain-like
SuperFamilySSF466891.58E-151983IPR009057Homeodomain-like
PROSITE profilePS5007115.4672484IPR001356Homeobox domain
SMARTSM003891.8E-142688IPR001356Homeobox domain
CDDcd000863.56E-132783No hitNo description
PfamPF000462.3E-152883IPR001356Homeobox domain
PROSITE profilePS5082716.873519578IPR018501DDT domain
SMARTSM005712.7E-20519578IPR018501DDT domain
PfamPF027915.4E-17520575IPR018501DDT domain
PfamPF050661.3E-15701768IPR007759HB1/Asxl, restriction endonuclease HTH domain
PfamPF156129.9E-8910949IPR028942WHIM1 domain
PfamPF156137.0E-1410901162IPR028941WHIM2 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1746 aa     Download sequence    Send to blast
MEIADGGDGN PPPEGWKKPP EGGEDKPSKR KMKSPYQLEI LEKTYAVETY PSETLRAELS  60
AKTGLSDRQL QMWFCHRRLK DRKFAPGKKA KKVEEPPSPP PPGEDLASVE AQLGEPLRDD  120
GPILGVEFDP LPPGAFGAPI GMSTQAKQLV RPYDGKSMKI QTSALLPSME HSFLSGSLTG  180
KRKAAASGAH SVHPQVPPRA LQEYQFLPEQ PSIRSESYER VPQSHFYDPP VSTPSTRIPS  240
LPAGNQYLHG NDQIAPTYTF QGHISSSGLL SQQAREQLYT NEYDGAPHGS PFRNSTADPQ  300
FSIHQTLGLE NPFSLSERRI VREEDSCRID RKRKSEEARI AKEVEAHEKR IRKELEKQDI  360
LRRKREEQMR REMERLDRDR RKEEERILRE KQREEERFLR EQRRENERRE KIMLKENRRA  420
EKLRRKEELR KQKEAARLKA ANERATARRI AKESMELIED ERLELMELAA SRKGLSSIIS  480
LDCDTLEQLD SFKVMLNAFP PKSVKLKKPF SVQPWIESEE NVGNFLMAWK FLITFADVLG  540
LWPFTLDEFL QSLHDYDSRL LGEIHVALLK SIIKDIEEFA RTPAVALGVN QNSVGNPGGG  600
HPHIVEGAYA WGFNICSWQQ HLNYFTWPEI LRQFALAAGF GPQLKKRNVE RTYFRDGHED  660
NDGEDIISTL RNGAAAENAV ALMQVRGYNH RRRPRHRLTP GTVKFAAFHV LSLEGSKGLT  720
ILDVAEKIQK SGLRDLTTSK TPEASIAAAL SRDTKLFERT APSTYCVRAP FRKNPVDADA  780
IFAAARERIQ AFQSGFSDSD EVEKDADDGD DGERDEDSEF ENADEPEVDD CSVEAKMNKD  840
LPYMTKLRGA LTSNSANNKK KEILCDGIVL TPPNSLRHSD KVFQDALPNS KQASTNLEGA  900
EIDESNLGDP WVQGLTEGDY ADLSVEERLN ALVALIGVAI EGNSIRLILE ERLEAATALK  960
KQMWAEAQLD KRRYKEEYLN KSQYSSFLIC KPESAQAITG TDGCQTPLQL PYTKENDGNL  1020
EFLGNDQFPD ASSLNNIHNL PVERNGLGQE FSANPESSFT LQHYGHAAEK PRFQLKSYIG  1080
HKAEQLYVYR SLPLGQDRRR NRYWLFSTSA SPNDPGSGRI FFESRDGLWR LIDSEETFDS  1140
LLDALDTRGI RESHLHSMLQ RIETTFKEAL ARHKKHAASA KTSGFHFKPG SNESIRSPDC  1200
YTEHDSPSST HSGVTSDSVE CSTSFRIQLG RSKMERMSAL KRYHGFLKWM WKECCNNPLL  1260
LCAVRYGKKR CSELLQTCQI CYQSYFAEER HCTSCHRMFK SIHKGDAMFA EHIANCIVKR  1320
KVDKDSESQM VDSSLPIGVH LLKTQLSLVE VSIPAEALQP FWTEGYRKSW GVKLNSASSA  1380
DDFLQLLTLL EGAIKREHLS SNFETTNELL SSAKVSSAAA NSTSISGSVP VLPWIPDTTS  1440
AVALRLLELD ASISYMPQQK SASLKGESRD FFKPSRFTVV KKLHEFEPAG TPERVDYQIE  1500
GRWLDSSSGR RGRGRGSRGG RVGRGRGRGG RGTRATSIVS TSDFNEENIS NLVKKRKLSG  1560
RGRTRGRGRR RGRRSVRPRQ RSESQVPSSR ATFFHSFGDV GACSKEESAE ESLRSSGGDE  1620
WGIEGQNYIK QDDNSAGSQS LDDNEQVSGD EYDEPVPKYG ARYNQSSSIG GMDDESEEEE  1680
MDEDAEEEED YGDQGALEDM EDEVDEDDEE MVEDDEMTDA DDANGDEDGD EDEEEGPSSF  1740
SSGYSD
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
11630KKPPEGGEDKPSKRK
2690697RRRPRHRL
315621572RTRGRGRRRGR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008811887.10.0PREDICTED: uncharacterized protein LOC103722930 isoform X1
SwissprotQ9FFH10.0RLT2_ARATH; Homeobox-DDT domain protein RLT2
TrEMBLM0TY200.0M0TY20_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr9P06610_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP22833352
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G44180.10.0Homeodomain-like transcriptional regulator